PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04535.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 912aa    MW: 104347 Da    PI: 7.4959
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04535.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.72.8e-10761501489
                              T-EE--HHH.HTT....---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                       B3  14 grlvlpkkfaeeh....ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                               +l++p +f++++    ++++e+++t  l++ +s  +W+v+l  +++    +l +GW +F+ an+L+ g +v+ +++g+  
  Rsa1.0_04535.1_g00001.1  76 TQLMIPSDFFSNYiketSLDSETTTTAELKSdSSDITWKVEL--TGR----ILNDGWGDFAVANNLQIGNVVLVRYEGDLV 150
                              469*******999**99777788889999985777*******..555....6***********************987533 PP

2B359.27.5e-19200291197
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++ ++p+d+ + +rl+lp+ f++e+g++k+e  ++++  ++g +W + l  +kk+  + l+kGWkeFvkangL++g ++ ++  +
  Rsa1.0_04535.1_g00001.1 200 FVTFTLPPDYATICRLTLPNLFVKENGMNKPE--EIRVLGKDGTKWPISLLLDKKG-IMSLGKGWKEFVKANGLETGFTLKLM--W 280
                              778889********************999665..8***************777776.568*****************988888..8 PP

                              SSEE..EEEEE CS
                       B3  87 rsefelvvkvf 97 
                              ++++++ ++++
  Rsa1.0_04535.1_g00001.1 281 EEDTTPSFSLC 291
                              88999998887 PP

3B364.61.5e-20376468397
                              EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                       B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                               ++++  +l+++ l+lp+ f+ ++g+   + ++++l d  grsWe+ l+++ +s+ ++++ GW++F+++ngL++g f++Fk  g +
  Rsa1.0_04535.1_g00001.1 376 VAFVTDWSLNTDTLYLPRYFTCSNGLTR-KCRKIVLIDAGGRSWELDLRFNESSDIFYISPGWRSFCDENGLEAGGFFTFKIGG-N 459
                              56778889999**********9**9985.557*************************************************655.7 PP

                              EE..EEEEE CS
                       B3  89 efelvvkvf 97 
                              ++++v++++
  Rsa1.0_04535.1_g00001.1 460 GETPVLSFC 468
                              777898887 PP

4B354.22.7e-17527617197
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++ ++p+d+ +++ l+lpk f++e+g++k++  ++ l  ++g +W  +l  +kk+  + l+kGWk+FvkangL++g ++ ++  +
  Rsa1.0_04535.1_g00001.1 527 FITFTLPPDYATLDKLTLPKLFVKENGINKPG--EIYLLGKDGTKWLTRLLLDKKG-LMRLGKGWKDFVKANGLESGFTLKLM--W 607
                              778889*********************99766..8***************776665.568*****************999999..4 PP

                              SSEE..EEEEE CS
                       B3  87 rsefelvvkvf 97 
                               +++++ ++++
  Rsa1.0_04535.1_g00001.1 608 -EDTTPSFSLC 617
                              .4555555554 PP

5B348.81.2e-15682776199
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++  +++ +l+ +rl+lp +f++e++++k++   + l  ++  +W  +l ++ ++gr+ l+kGW+ F+k+n+ k g+fv+++ ++
  Rsa1.0_04535.1_g00001.1 682 FLTLAISPTSLRCNRLRLPMPFLRENSMDKPG--VIYLLGKDDTKWMANL-IQEGDGRTKLGKGWRAFAKENEFKPGEFVTLESIW 764
                              5566678889999*************999766..7***************.58888999************************999 PP

                              SSEE..EEEEE-S CS
                       B3  87 rsefelvvkvfrk 99 
                               ++++ +++++r+
  Rsa1.0_04535.1_g00001.1 765 -EDETTMIRFLRT 776
                              .555568888775 PP

6B338.12.7e-12810901296
                              EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                       B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                              ++ ++++   k ++l+lp +f++++g +k +  ++t+  e+  + + +l    + g + l++GW eF++ang+k g++++++ +++
  Rsa1.0_04535.1_g00001.1 810 VTLTLTHEDVKACMLILPCQFLKANGFNKLG--KITVLGENRIELSAYL--LSREGIVALETGWGEFCEANGVKLGESFTLECIKE 891
                              56666777788899***********999766..79999*9999999999..888889*************************9988 PP

                              .SEE..EEEE CS
                       B3  88 .sefelvvkv 96 
                               +e+ +v+kv
  Rsa1.0_04535.1_g00001.1 892 qDETAPVLKV 901
                              6777777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.51863159IPR003340B3 DNA binding domain
SuperFamilySSF1019368.24E-1364158IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-1364157IPR015300DNA-binding pseudobarrel domain
CDDcd100172.15E-1064154No hitNo description
SMARTSM010194.1E-1466159IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-17194287IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-16195291IPR015300DNA-binding pseudobarrel domain
CDDcd100171.97E-15198285No hitNo description
PfamPF023623.3E-17200291IPR003340B3 DNA binding domain
PROSITE profilePS5086313.507200294IPR003340B3 DNA binding domain
SMARTSM010191.7E-22200294IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-19367469IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-21371469IPR015300DNA-binding pseudobarrel domain
CDDcd100172.84E-16374468No hitNo description
PROSITE profilePS5086315.495374470IPR003340B3 DNA binding domain
PfamPF023625.9E-18375468IPR003340B3 DNA binding domain
SMARTSM010194.0E-25375471IPR003340B3 DNA binding domain
SuperFamilySSF1019368.24E-17521610IPR015300DNA-binding pseudobarrel domain
CDDcd100179.30E-16525618No hitNo description
Gene3DG3DSA:2.40.330.104.4E-16526611IPR015300DNA-binding pseudobarrel domain
PfamPF023621.8E-15527617IPR003340B3 DNA binding domain
PROSITE profilePS5086313.338527637IPR003340B3 DNA binding domain
SMARTSM010198.0E-23527620IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-14677773IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-17678779IPR015300DNA-binding pseudobarrel domain
PfamPF023622.4E-14682775IPR003340B3 DNA binding domain
PROSITE profilePS5086313.296682777IPR003340B3 DNA binding domain
SMARTSM010199.3E-20682777IPR003340B3 DNA binding domain
CDDcd100171.36E-13692775No hitNo description
Gene3DG3DSA:2.40.330.101.2E-12806898IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-14808892IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-10808891No hitNo description
PfamPF023622.2E-11809900IPR003340B3 DNA binding domain
PROSITE profilePS508639.474809905IPR003340B3 DNA binding domain
SMARTSM010198.5E-14809905IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 912 aa     Download sequence    Send to blast
MKRKMKITRQ LCREMKSRQR RERETKNTKS PWKRERGGGE DEMARESAWT TVMAKSTTLL  60
LLRPQFFHTL LPGFQTQLMI PSDFFSNYIK ETSLDSETTT TAELKSDSSD ITWKVELTGR  120
ILNDGWGDFA VANNLQIGNV VLVRYEGDLV FHVSDLGPSF SQIQHIKPPP QNTNDDDESL  180
MEKFQQKQRP VSYSSCHKRF VTFTLPPDYA TICRLTLPNL FVKENGMNKP EEIRVLGKDG  240
TKWPISLLLD KKGIMSLGKG WKEFVKANGL ETGFTLKLMW EEDTTPSFSL CCAESASDRD  300
EEAYLESIKK QSLSIDRRIR DKSSKDERRS WEREKIHLRG RSYVGDIEEV PINKKVKTNS  360
HGTEAVSSSL DNSCFVAFVT DWSLNTDTLY LPRYFTCSNG LTRKCRKIVL IDAGGRSWEL  420
DLRFNESSDI FYISPGWRSF CDENGLEAGG FFTFKIGGNG ETPVLSFCPM ESMDSRRQTY  480
CLEASNEKED IERKRNEEEA LVDIEKKGKP KHRPVSYSSY SPCYKRFITF TLPPDYATLD  540
KLTLPKLFVK ENGINKPGEI YLLGKDGTKW LTRLLLDKKG LMRLGKGWKD FVKANGLESG  600
FTLKLMWEDT TPSFSLCCAG STGDKDQEEY LEVIKQRSLS IDRRIRDKIS KDENNEEEKR  660
SWEREKINIS GRDSTTPSQK RFLTLAISPT SLRCNRLRLP MPFLRENSMD KPGVIYLLGK  720
DDTKWMANLI QEGDGRTKLG KGWRAFAKEN EFKPGEFVTL ESIWEDETTM IRFLRTESES  780
SKANKKESIY TEDTEPRTRD SSLAIHDRFV TLTLTHEDVK ACMLILPCQF LKANGFNKLG  840
KITVLGENRI ELSAYLLSRE GIVALETGWG EFCEANGVKL GESFTLECIK EQDETAPVLK  900
VGETEGKEEA LQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1820RQLCREMKSRQRR
21722RQRRER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133979.10.0PREDICTED: B3 domain-containing protein REM13-like
TrEMBLA0A078D1H70.0A0A078D1H7_BRANA; BnaA03g22950D protein
STRINGBra000564.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137801326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.11e-173DNA binding;DNA binding;sequence-specific DNA binding transcription factors